Margatoxin TFA | MedChemExpress (MCE)
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research[1][2].
| Trivial name | Margatoxin TFA |
| Catalog Number | HY-P1280A |
| Research Area | Neurological Disease |
| Purity | ≥98.00% |
| SMILES | [TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH(Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36) (TFA salt)] |
| Size | 1 mg |
| Supplier Page | https://www.medchemexpress.com/margatoxin-tfa.html |