CJC1295 Without DAC
Modified Growth Releasing Factor aminos 1-29, usually referred to as Modified GRF (1-29) or “ModGRF(1-29),” also known as CJC-1295 without DAC, is a synthetic analog of the endogenous peptide signaling hormone Growth Hormone Releasing Hormone (GHRH).
| Catalog Number | HB00107 |
| Alternative Name(s) | CJC-1295(2MG),CJC-1295(10mg),CJC-1295 Acetate,CJC-1295 CJC-1295,CJC1295 with out DAC,CJC-1295 Without DAC 86328-34-0,Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2,-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl |
| Molecular Formula | C152H252N44O42 |
| CAS# | 863288-34-0 |
| Purity | >95% |
| Size | Inquiry |
| Supplier Page | https://www.creative-peptides.com/product/cjc1295-without-dac-item-hb00107-850.html |