Sermorelin
Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues
| Catalog Number | HB00118 |
| Alternative Name(s) | Semorelin,SERMORELIN,Sermorelin Aceta,Sermelin Acetate,SERMORELIN ACETATE,GRF (1-29) AMIDE (HUMAN),GHRF (1-29), AMIDE, HUMAN,Green tea powdered extract,YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2,GRF (1-29) aMide (huMan) SerMorelin |
| Molecular Formula | C149H246N44O42S |
| CAS# | 86168-78-7 |
| Purity | >95% |
| Size | Inquiry |
| Supplier Page | https://www.creative-peptides.com/product/sermorelin-item-hb00118-863.html |