Lunasin | MedChemExpress (MCE)
Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer and anti-aging properties. Lunasin can be isolated from soybean. Lunasin also has an epigenetic mechanism of action associated with histone acetylation. Lunasin can be internalized into cells and inhibit Oncosphere formation in cancer cells[1].
Trivial name | Lunasin |
Catalog Number | HY-P5285 |
Research Area | Inflammation/Immunology; Infection; Cancer |
CAS# | 496823-34-8 |
Purity | ≥98.00% |
SMILES | [SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD] |
Size | 1 mg |
Supplier Page | https://www.medchemexpress.com/lunasin.html |