SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide.

SEB Domain 144-153 is Staphylococcal Enterotoxin B domain amino acid residue 144-153. SEB Domain 144-153 inhibits transcytosis of multiple staphylococcal enterotoxins, SEA, SEE, and TSST-1. Staphylococcal enterotoxin B (SEB) is a toxin produced by Staphylococcus aureus.

Secernin-1

Secretin (28-54), human is a 27-amino acid residue C-terminally amidated peptide, which acts on secretin receptors.

Secretin (33-59), rat is a 27-aa peptide, acts on secretin receptor, enhances the secretion of bicarbonate, enzymes, and K+ from the pancreas.

Secretin stimulates the secretion of bicarbonate by the pancreas and inhibits the gastrin and acid production in the stomach. It also potentiates the release of digestive enzymes from the pancreas triggered by cholecystokinin.

Secretin stimulates the secretion of bicarbonate by the pancreas and inhibits the gastrin and acid production in the stomach. It also potentiates the release of digestive enzymes from the pancreas triggered by cholecystokinin.

Secretin Acetate is a hormone that controls the secretions into the duodenum, and also separately, water homeostasis throughout the body.

Secretin, canine is an endocrine hormone that stimulates the secretion of bicarbonate-rich pancreatic fluids. Secretin, canine can regulates gastric chief cell function and paracellular permeability in canine gastric monolayers by a Src kinase-dependent pathway.

Secretin, porcine is a 27-amino acid peptide, acting on pancreatic acinar cells and ductal epithelial cells stimulating the production of bicarbonate rich fluid.

Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes.

Selank is a 7-amino-acid peptide that is the synthetic equivalent of the naturally occurring peptide called tuftsin.

Selepressin (INN), also known as [Phe(2),Ile(3), Hgn(4),Orn(iPr)(8)]vasopressin) is a potent, highly selective, short-acting peptide full agonist of the vasopressin 1A receptor and analog of vasopressin which is under development by Ferring Pharmaceuticals for the treatment of vasodilatory hypotension in septic shock.

Semaglutide is a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which is used in combination with diet and exercise in the therapy of type 2 diabetes, either alone or in combination with other antidiabetic agents.

Semax (Met-Glu-His-Phe-Pro-Gly-Pro) is an analog of the adrenocorticotropin fragment (4-10).

Senktide is shown to selectively interact with a tachykinin receptor subtype (SP-N) and can be used in studies to find out the regulation, distribution, and functional role of this receptor. This compound is also reported to be an NK-3R agonist and may cause behavior similar to serotonergic stimulation in murine models.

Serine protease hepsin

Serine protease hepsin

Serine protease hepsin

Serine/threonine-protein kinase B-raf

Serine/threonine-protein kinase mTOR

Semaglutide is a recombinant DNA produced polypeptide analog of human glucagon-like peptide-1 (GLP-1) which is used in combination with diet and exercise in the therapy of type 2 diabetes, either alone or in combination with other antidiabetic agents.

Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues

Sermorelin, also known as GHRH (1-29), is a growth hormone-releasing hormone (GHRH) analogue used as a diagnostic agent. It is a 29-amino acid polypeptide representing the 1–29 fragment from endogenous human GHRH, and is thought to be the shortest fully functional fragment of GHRH. It is used as a diagnostic agent to assess growth hormone […]