Steviol is a major metabolite of the sweetening compound stevioside. Steviol slows renal cyst growth by reducing AQP2 expression and promoting AQP2 degradation.

Steviolbioside is a rare sweetener that exists in stevia rebaudiana leaves. Steviolbioside presents inhibition on several human cancer cells and acts as potential remedy for human breast cancer.

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

Stigmasterol glucoside is a sterol isolated from P. urinaria with high antioxidant and anti-inflammatory activities, act as an inhibitor of 5α-reductase with an IC50 of 27.2?μM[2].IC50 & Target: IC50：27.2?μM (5α-reductase)[2]

STIMA-1 is an active compound. STIMA-1 can restore the activity of p63. STIMA-1 can activate the proliferation and differentiation of keratinocytes.

STING agonist-16 (1a) is a specific stimulator of interferon genes (STING) agonist. STING agonist-16 (1a) can be used as a potential antiviral and antitumor tool.In Vitro: STING agonist-16 (1a) (0-100 μM, 6 h) can promote mRNA expression of IFNβ, CXCL-10 and IL-6 in a dose-dependent manner with no significant cytotoxic effect up to 100 μM […]

STING-IN-2 (C-170) is a potent and covalent STING inhibitor. STING-IN-2 efficiently inhibits both mouse STING (mmSTING) and human STING (hsSTING). STING-IN-2 can be used for autoinflammatory disease research.In Vitro: THP-1 cells are pretreated with STING-IN-2 (C-170; 0.5 μM) and stimulated with cGAMP. STING-IN-2 (C-170) treatment decreases the IFNB1 and TNF mRNA levels, and also reduces […]

STING-IN-3 is an inhibitor of stimulator of interferon genes (STING). STING-IN-3 efficiently inhibits both hsSTING and mmSTING through covalently target the predicted transmembrane cysteine residue 91 and thereby block the activation-induced palmitoylation of STING.IC50 & Target: STINGIn Vitro: STING-IN-3 (0.02-2 μM) inhibits hsSTING and mmSTING, mediated IFNβ reporter activity in HEK293 cells.

STM2457 is a first-in-class, highly potent, selective and orally active METTL3 inhibitor with an IC50 of 16.9 nM. STM2457 can be used for the research of acute myeloid leukaemia (AML)[2].In Vitro: STM2457 (Compound 72) inhibits MOLM13 cells proliferation with an IC50 of 8.699 μM.

Streptavidin is a ～60 kDa homotetramer. Streptavidin binds four molecules of biotin with the highest affinity. The binding affinity of biotin to streptavidin is one of the highest reported for a non-covalent interaction to date, with a KD ～ 0.01 pM. Streptavidin has an immunosuppressive role[2].In Vitro: Streptavidin (2-200 μg/mL) significantly suppresses the proliferation of […]

Streptozotocin (Streptozocin) is a potent DNA-methylating antibiotic. Streptozotocin causes methylation of liver and kidney and pancreatic DNA, but no methylation in brain DNA.IC50 & Target:DNA alkylatorIn Vitro:Streptozotocin (STZ) shows higher cytotoxic effect in vitro on hematological cell lines compared to Alloxan (ALX). ALX appeares not to be toxic for the studied cell lines with estimated […]

Strictosidinic acid, an orally active glycoside indole monoterpene alkaloid isolated from Psychotria myriantha leaves, inhibits precursor enzymes of 5-HT biosynthesis and reduces the 5-HT levels. Strictosidinic acid has peripheral analgesic and antipyretic activities in mice[2].In Vivo: Strictosidinic acid (20 μg/μl; intra-hippocampal injection) causes a significance of 83.5% reduction in 5-HT levels. Strictosidinic acid (10 mg/kg; […]

Strombine is a imino acid produced by a dehydrogenase. Strombine is a compound present in the hemolymph that is capable of cryoprotection[2].

Strophanthidin is a naturally available cardiac glycoside. Strophanthidin 0.1 and 1 nmol/L increases and 1~100 μmol/L inhibits the Na+/K+-ATPase activities, but Strophanthidin 10 and 100 nmol/L does not affect Na+/K+-ATPase activities in cardiac sarcolemmal[2]. Strophanthidin increases both diastolic and systolic intracellular Ca2+ concentration.IC50 & Target: Na+/K+-ATPase[2]In Vitro: Strophanthidin (0~10 μM; 24 hours; MCF-7, A549, and […]

Styraxlignolide F is a natural compoundisolated from Styrax japonica.

SU0268 is a potent and specific inhibitor of 8-Oxoguanine DNA glycosylase 1 (OGG1). SU0268 regulates inflammatory responses during Pseudomonas aeruginosa infection[2].In Vitro: MTH1-depleted cells are less sensitive to the OGG1-specific inhibitor, SU0268 (5-10 μM), than their control shGFP counterparts.SU0268/IACS-4759 (5-20 μM, 48h) co-treated cells are more viable than the correspondingly-treated IACS-4759- or SU0268-treated cells.SU0268 does […]

SU056 is a YB-1 inhibitor. SU056 induces cell-cycle arrest, apoptosis, and inhibits cell migration in ovarian cancer cells. SU056 interacts with YB-1 and inhibits and its associated downstream proteins and pathways. SU056 can enhance the cytotoxic effects of Paclitaxel (HY-B0015).IC50 & Target:YB-1In Vitro:SU056 (0-10 μM approximately, 48 h) inhibits cell growth in OVCAR3/4/5/8, SKOV3 and […]

SU4312 is the racemate of (Z)-SU4312 and (E)-SU4312. (Z)-SU4312 inhibits PDGFR and FLK-1 with IC50s of 19.4 and 0.8 μM, respectively. (E)-SU4312 inhibits PDGFR, FLK-1, EGFR, HER-2, and IGF-1R with IC50s of 24.2, 5.2, 18.5, 16.9 and 10.0 μM, respectively.In Vitro: Receptor tyrosine kinases (RTKs) have been shown to be important mediators of cellular signal […]

SU5201 is an inhibitor of interleukin-2 (IL-2) production.

SU5204, a tyrosine kinase inhibitor, has IC50s of 4 and 51.5 μM for FLK-1 (VEGFR-2) and HER2, respectively.

SU5205 is an inhibitor of VEGFR2 (FLK-1), with an IC50 of 9.6 μM.IC50 & Target: IC50: 9.6 μM (VEGFR2 FLK-1)In Vitro: SU5205 inhibits ligand-induced endothelial mitogenesis for VEGF with an IC50 of 5.1 μM.

SU5214 is a potent VEGFR2 inhibitor extracted from patent US5834504A, SU5214, has IC50s of 14.8 μM (FLK-1) and 36.7 μM (EGFR), respectively.IC50 & Target: IC50: 14.8 μM (FLK-1); 36.7 μM (EGFR)

Subasumstat (TAK-981) is a first in class and selective inhibitor of the SUMOylation enzymatic cascade, with potential immune-activating and antineoplastic activities[2].IC50 & Target: SUMOylation.In Vitro: Subasumstat (TAK-981) is able to increase the production of type 1 IFN, thereby increasing type 1 IFN-mediated signaling, activating innate effector cells and enhancing the antitumor innate immune responses.In Vivo: […]

Substance P TFA (Neurokinin P TFA) is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R).IC50 & Target: Neurokinin 1 receptorIn Vitro: The neuropeptide substance P (SP) that are mediated by the neurokinin 1 receptor (NK1-R) desensitize and resensitize, […]

Suc-AAPF-pNA (Suc-Ala-Ala-Pro-Phe-pNA) is a chromogenic p-nitroanilide (pNA) substrate with the Km of 1.7 mM. Suc-AAPF-pNA can be used for the Measurement of free and membrane-bound cathepsin G in human neutrophils.

Suc-Gly-Pro-AMC is a fibroblast activation protein (FAP)-specific substrate. Suc-Gly-Pro-AMC can be used to study the activity of FAP.

Succinic anhydride is a cyclic anhydride and a nonclaevable ADC linker extracted from patent WO2009064913A1. Succinic anhydride can react with compound 4 of the patent to link the prodrug to an amine or hydroxy 1 group of a targeting polypeptide.

Sucrose-epichlorohydrin copolymer acts as a macromolecular crowder and promotes protein liquid-liquid phase separation (LLPS) .

Sucunamostat (SCO-792) hydrochloride is an orally active and reversible enteropeptidase inhibitor with IC50s of 4.6 nM and 5.4 nM for rat enteropeptidase and human enteropeptidase, respectively. Sucunamostat hydrochloride can slowly dissociate from enteropeptidase in vitro and inhibit protein digestion in vivo.IC50 & Target:IC50: 4.6 nM (rat enteropeptidase), 5.4 nM (human enteropeptidase)In Vivo:Sucunamostat hydrochloride (10 and […]

Sudan Black B, a fat-soluble diazo dye, is a histochemical stain. Sudan Black B can be used for staining of neutral triglycerides and lipids.In Vitro: Sudan Black B works also in frozen material, and therefore can be complementarily used with SA-β-gal when investigating senescence. Sudan Black B is a highly lipophilic agent that exhibits high […]

Sudoxicam is a reversible and orally active COX antagonist and a non-steroidal anti-inflammatory drug (NSAID) from the enol-carboxamide class. Sudoxicam has potent anti-inflammatory, anti-edema and antipyretic activity[2].IC50 & Target: COXIn Vitro: Sudoxicam demonstrates NADPH-dependent covalent binding to human liver microsomes. With addition of glutathione (GSH) in microsomal incubations, about half of the covalent incorporation of […]

Sulbactam (CP45899) sodium is a competitive, irreversible beta-lactamase inhibitor. Sulbactam sodium shows antimicrobial activity against multidrug-resistant (MDR) acinetobacter calcoaceticus–Acinetobacter baumannii (Acb) complex[2].In Vitro: Ampicillin-Sulbactam has a wide range of antibacterial activity that includes Gram-positive and Gram-negative aerobic and anaerobic bacteria.

Sulbactam pivoxil is a prodrug of sulbactam. Sulbactam is a β-lactamase inhibitor which poorly adsorbed from gastrointestinal tract. Sulbactam pivoxil has a better absorption than the parent drug and provides high serum levels after oral administration.

Sulcatone is an endogenous metabolite.

Sulfachloropyridazine-d4 is the deuterium labeled Sulfachloropyridazine. Sulfachloropyridazine is a broad spectrum sulfonamide used against both Gram-positive and Gram-negative aerobic bacteria.In Vitro: Stable heavy isotopes of hydrogen, carbon, and other elements have been incorporated into drug molecules, largely as tracers for quantitation during the drug development process. Deuteration has gained attention because of its potential to […]

Sulfadiazine sodium is a sulfonamide?antibiotic with antimalarial activity. Sulfadiazine can be used for toxoplasmosis research[2].In Vivo: In this study, the effectiveness of Sulfadiazine sodium and Pyrimetamine for the treatment of mice during acute infection with different atypical T. gondii strains was evaluated. Swiss mice were infected with seven T. gondii strainsl. The infected mice were […]

Sulfadimethoxine-d6 (Sulphadimethoxine-d6) is the deuterium labeled Sulfadimethoxine. Sulfadimethoxine is a sulfonamide antibiotic used to treat many infections.

Sulfamethoxazole-13C6 is a 13C labeled Sulfamethoxazole. Sulfamethoxazole (Ro 4-2130) is a sulfonamide bacteriostatic antibiotic, used for bacterial infections. Sulfonamides is a competitive antagonist of para-aminobenzoic acid (PABA).

Sulfamethoxazole D4 (Ro 4-2130 D4) is a deuterium labeled Sulfamethoxazole (Ro 4-2130). Sulfamethoxazole is a sulfonamide bacteriostatic antibiotic.

Sulfo-ara-F-NMN (CZ-48) is a mimetic of nicotinamide mononucleotide (NMN). Sulfo-ara-F-NMN acts selectively, activating SARM1 but inhibiting CD38 (IC50 around 10 μM). Sulfo-ara-F-NMN induces intracellular cyclic ADP-ribose (cADPR) production.In Vitro: Sterile alpha and Toll/interleukin-1 receptor motif-containing 1 (SARM1) is an adaptor protein in the Toll-like receptor pathway. Sulfo-ara-F-NMN activates SARM1 to produce cyclic ADP-ribose and induces […]

Sulfo-Cyanine5.5 NHS ester tripotassium is an amine-reactive ester of sulfonated far-red Cyanine5.5 fluorophore, which can be used to label antibodies, proteins, etc., as well as for in vivo NIR imaging.

Sulfo-NHS-LC-Biotin sodium is an amine-reactive biotinylation reagent that can be used for antibody labeling.