Nifurpirinol (P-7138) is a nitroaromatic antibiotic and acts as a novel substrate for the bacterial nitroreductase (NTR) enzyme. Nifurpirinol is a more potent prodrug compared to Metronidazole to trigger cell-ablation in nitroreductase expressing transgenic models.IC50 & Target: IC50: bacterial nitroreductase (NTR) enzyme

Nile blue chloride is a highly fluorescent and photostable organic dye. Nile blue chloride and fluorescein isothiocyanate (FITC) can be used to construct a ratiometric pH sensitive probe for tracking the pH of the extracellular fluid between cancer cells in realtime. Nile Blue chloride has the potential for the research of nonlinear optics[2].

Nilofabicin is an enoyl-(acyl-carrier protein) reductase (FabI) inhibitor. Nilofabicin had an MIC(90) of 0.5 microg/ml for Staphylococcus aureus strains and was more potent than either linezolid or vancomycin.

Nilotinib D6 (AMN107 D6) is a deuterium labeled Nilotinib. Nilotinib is an orally available Bcr-Abl tyrosine kinase inhibitor with antineoplastic activity.

Nimotuzumab is a humanized IgG1 monoclonal antibody targeting EGFR with a KD of 0.21 nM. Nimotuzumab is directed against the extracellular domain of the EGFR blocking the binding to its ligands. Nimotuzumab, a strong antitumor drug, is cytolytic on target tumors by its capacity to cause antibody dependent cell mediated cytotoxicity (ADCC) and complement dependent […]

Ninhydrin can be used as a chromogenic analytical probe for the quantification of amino acids and proteins.IC50 & Target: IC50: chromogenic analytical probeIn Vitro: Ninhydrin is used in amino acid analysis of proteins. Except?proline, Most amino acids can be?hydrolyzed?and react with ninhydrin. The amino acids are then quantified colorimetrically after separation by?chromatography.Ninhydrin reacts with primary […]

Nipocalimab (M281) is a fully human, recombinant, aglycosylated IgG1 monoclonal antibody. Nipocalimab is a human deglycosylated IgG1 anti-FcRn monoclonal antibody that binds with picomolar affinity to Fc receptor (FcRn) at both endosomal pH 6.0 and extracellular pH 7.6[2].

Niraparib (MK-4827) tosylate hydrate is a highly potent and orally bioavailable PARP1 and PARP2 inhibitor with IC50s of 3.8 and 2.1 nM, respectively. Niraparib tosylate hydrate leads to inhibition of repair of DNA damage, activates apoptosis and shows anti-tumor activity[2].In Vitro: Niraparib (MK-4827) tosylate hydrate inhibits PARP activity with EC50=4 nM and EC90=45 nM in […]

Nirmatrelvir (PF-07321332) is a potent and orally active SARS-CoV?3C-like protease (3CLPRO) inhibitor. Nirmatrelvir (PF-07321332) targets to the SARS-CoV-2 virus and can be used for COVID-19 research.IC50 & Target:IC50: 3CLPROIn Vitro:3CLPRO is responsible for cleaving polyproteins 1a and 1ab of SARS-CoV-2.1.?Without the activity of the SARS-CoV-2 3CLPRO, nonstructural proteins (including proteases) cannot be released to perform […]

Nirsevimab (MEDI8897) is a recombinant human respiratory syncytial virus (RSV) monoclonal antibody with modified Fc region, which can prolong its half-life. Nirsevimab has an affinity for RSV-B with an Kd value of 1.5 nM. Nirsevimab can be used for RSV research[2].

Nisoxetine is a potent and selective inhibitor of noradrenaline transporter (NET), with a Kd of 0.76 nM. Nisoxetine is an antidepressant and local anesthetic, it can block voltage-gated sodium channels[2].IC50 & Target:Kd: 0.76 nM (NET)In Vitro:Nisoxetine inhibits [3H]Nisoxetine binding to rat frontal cortical membranes with a Ki of 1.4±0.1 nM[2].Nisoxetine inhibits [3H]Noradrenaline uptake into rat […]

Nitazoxanide D4 (NTZ D4) is the deuterium labeled Nitazoxanide, which is an antiprotozoal agent.

NITD-688 is an orally active pan-serotype inhibitor of the dengue virus NS4B protein. NITD-688 can be used in the research of dengue virus (DENV).IC50 & Target:NS4BIn Vitro:NITD-688 shows antiviral activity against all four serotypes of dengue virus (DENV), with EC50 values of 8 to 38 nM.NITD-688 shows antiviral activity against DENV-2 infected PBMCs, with an […]

Nitenpyram is a calss of neonicotinoid and an insect nicotinic acetylcholine receptor (nAChR) agonist with an IC50 of 14 nM. Nitenpyram is an oral fast-acting insecticide used to suppress sucking insects on companion animals[2].In Vivo: Nitenpyram is administered orally (1 mg/kg) for the short-term control of fleas in dogs and cats. Fleas start to fall […]

Nitrobenzylthioinosine is an ENT1 transporter inhibitor that binds to ENT1 transporter with high affinity. Nitrobenzylthioinosine is a photoaffinity probe for adenosine uptake sites in brain. Nitrobenzylthioinosine can cross the blood-brain barrier[2].IC50 & Target: ENT1 transporter

Nitroxynil, anthelmintic agent, is active against parasites in both adult and immature stages. Nitroxynil is widely used for the research of infection of Fasciola hepatica[2].

NJH-2-057 is an EN523 OTUB1 recruiter linked to lumacaftor, a drug used to treat cystic fibrosis that binds ΔF508-CFTR.

NLRP3-IN-10 is a potent NLRP3?inhibitor, inhibits IL-1β release with an IC50 value of 251.1 nM. NLRP3-IN-10 suppresses NLRP3 inflammasome activation by attenuating ASC speck formation.IC50 & Target:IC50: 250.1 nM (NLRP3)In Vitro:NLRP3-IN-10 (compound 14c) (0.4, 1.6, 6.4 μM; 40 min) exerts remarkable inhibitory activity on NLRP3 inflammasome activation induced by LPS-MSU (12 h) in THP-1 cells […]

NLRP3-IN-11 is a NLR family pyrin domain containing 3 (NLRP3) proteins inhibitor. NLRP3-IN-11 has biological activity for NLRP3 with an IC50 value of

NLRP3-IN-13 (Compound C77 in reference patent) is a selective and potent NLRP3 inhibitor (IC50: 2.1 μM). NLRP3-IN-13 inhibits NLRP3 andNLRC4 inflammasomes, and inhibits NLRP3-mediated IL-1β production. NLRP3-IN-13 also inhibits NLRP3 ATPase activity. NLRP3-IN-13 can be used in the research of neuroinflammatory disorders.

NLRP3-IN-2, an intermediate substrate in the synthesis of glyburide, inhibits the formation of the NLRP3 inflammasome in cardiomyocytes and limits the infarct size following myocardial ischemia/reperfusion in the mouse, without affecting glucose metabolism.In Vivo: NLRP3-IN-2 is well tolerated with no effects on the glucose levels in vivo.NLRP3-IN-2 (100 mg/kg) treatment in a model of AMI […]

NLRP3-IN-NBC6 is a potent, selective NLRP3 inflammasome inhibitor (IC50= 574 nM) that acts independently of Ca2+. NLRP3-IN-NBC6 inhibits Nigericin (HY-127019)-induced inflammasome activation in THP-1 cells and Imiquimod (HY-B0180)-induced IL-1β release from LPS-primed bone marrow-derived macrophages (BMDMs).In Vitro: In LPS-primed primary BMDMs, NLRP3-IN-NBC6 (10 μM; 15 minutes) inhibits Imiquimod-induced IL-1β release. NLRP3-IN-NBC6 completely inhibits NLRP3-dependent IL-1β […]

NLRP3 / aim2-in-2 is a new potent inhibitor with different species-specific effects on NLRP3 and AIM2 inflammasome dependent cell death. Its < b > IC < sub > 50 < / sub > < / b > value is 0.2392 ± 0.0233 μ M。

NLS-StAx-h TFA is a selective, cell permeable, stapled peptide Wnt signaling inhibitor with an IC50 of 1.4 μM. NLS-StAx-h TFA efficiently inhibits β-catenin-transcription factor interactions. NLS-StAx-h TFA shows anti-proliferation of cancer cells[2].IC50 & Target:IC50: 1.4 μM (Wnt)In Vitro:NLS-StAx-h (10 μM; 72 h) inhibits proliferation of colorectal cancer cells.NLS-StAx-h (5 and 10 μM; 24 h) inhibits […]

NMDAR/TRPM4-IN-2 free base (compound 8) is a potent NMDAR/TRPM4 interaction interface inhibitor. NMDAR/TRPM4-IN-2 free base shows neuroprotective activity. NMDAR/TRPM4-IN-2 free base prevents NMDA-induced cell death and mitochondrial dysfunction in hippocampal neurons, with an IC50 of 2.1 μM. NMDAR/TRPM4-IN-2 free base protects mice from MCAO-induced brain damage and NMDA-induced retinal ganglion cell loss.In Vitro: NMDAR/TRPM4-IN-2 free […]

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

NNC-0640 is a potent human G-protein-coupled glucagon receptor (GCGR) negative allosteric modulator (NAM) with an IC50 of 69.2 nM.IC50 & Target: Human Glucagon Receptor

NNMTi is a potent nicotinamide?N-methyltransferase (NNMT) inhibitor (IC50=1.2 μM) and selectively binds to the NNMT substrate-binding site residues[2]. NNMTi ?promotes myoblast differentiation?in vitro and enhances fusion and regenerative capacity of muscle stem cells (muSCs)?in aged mice.In Vitro: NNMTi (10-30 μM; 96 hours) produces a concentration-related increase in myoblast differentiation on C2C12 myoblast differentiation. 30 μM […]

Nomegestrol acetate is an orally active, highly selective progestogen and a progesterone receptor complete agonist. Nomegestrol acetate inhibits ovulation. Nomegestrol acetate is also effective in inhibiting the proliferation of human endometrial cancer RL95-2 cells in vitro and in vivo. Nomegestrol acetate can be used in cancer (especially endometrial cancer) and contraceptive studies[2].IC50 & Target:Progesterone receptor.In […]

Nonactin is a naturally occurring macrotetrolide antibiotic from Streptomyces griseus. Nonactin acts as an ionophore for monovalent cations, including K+, and NH4+. Nonactin is able to uncouple the oxidative phosphorylation (OXPHOS) of mitochondria. Nonactin selectively induces apoptosis in cell lines harboring active mutant β-catenin[2]. Nonactin inhibits the surface expression of endogenous HSP60.

Nonadecanoic acid is a 19-carbon long saturated fatty acid. Nonadecanoic acid is the major constituent of the substance secreted by Rhinotermes marginalis to defence.

Nonanal is a saturated fatty aldehyde with antidiarrhoeal activity.In Vitro: Nonanal shows a significant activity against B. cereus and L. monocytogenes, the MIC values are both 7.8 μg/ml.In Vivo: Nonanal shows a significant inhibitory effect on mice with diarrhoea induced with castor oil.

Nonanoic Anhydride is a biochemical reagent that can be used as a biological material or organic compound for life science related research.

Nonapeptide-1 (Melanostatine-5) acetate salt, a peptide hormone, is a selective antagonist of MC1R (Ki: 40 nM). Nonapeptide-1 acetate salt is a competitive α-MSH antagonist that potently inhibits intracellular cAMP and melanosome dispersion induced by α-MSH in melanocytes (IC50: 2.5 nM and 11 nM, respectively). Nonapeptide-1 acetate salt inhibits melanin synthesis, and can be used in […]

Nonenylsuccinic anhydride is a biochemical reagent that can be used as a biological material or organic compound for life science related research.