Maurotoxin | MedChemExpress (MCE)
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K+ current with an IC50 of 2 nM[1][2].
Trivial name | Maurotoxin |
Catalog Number | HY-P5165 |
Research Area | Inflammation/Immunology |
CAS# | 188240-41-7 |
Purity | ≥98.00% |
SMILES | [VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC-NH2 (Disulfide bridge: Cys3-Cys24, Cys9-Cys29, Cys13-Cys19, Cys31 -Cys34)] |
Size | 1 mg |
Supplier Page | https://www.medchemexpress.com/maurotoxin.html |